PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr7P01060_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 859aa    MW: 94152.2 Da    PI: 6.0576
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr7P01060_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.89e-192683457
                           -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
               Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                             ++t+eq+e+Le+++ ++++ps  +r++L +++    +++ +q+kvWFqNrR +ek+
  GSMUA_Achr7P01060_001 26 YVRYTPEQVEALERVYSECPKPSSLRRQQLVRECpilsNIEPKQIKVWFQNRRCREKQ 83
                           6789****************************************************97 PP

2START167.97.2e-531733812205
                            HHHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS.SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-SEEEEEEEECTT. CS
                  START   2 laeeaaqelvkkalaeepgWvkssesengdevlqkfeeskvdsgealrasgvvdmvlallveellddkeqWdetlakaetlevissg. 88 
                            +aee+++e+++ka+ ++  Wv+++ +++g++++ +++ s+++sg a+ra+g+v  +++  v+e+++d++ W ++++ +++l vi +  
  GSMUA_Achr7P01060_001 173 IAEETLAEFLSKATGTAVDWVQMVGMKPGPDSIGIVAVSHNCSGVAARACGLVSLEPT-KVAEIIKDRPAWYRDCRCIDVLTVIPTSn 259
                            68999*****************************************************.7777777777*******999999997666 PP

                            .EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--....-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE CS
                  START  89 .galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe...sssvvRaellpSgiliepksnghskvtwvehvd 171
                             g ++l++++++a+++l++ Rdf+++Ry+r l++g++vi+++S+++ +  p+   s++++Rae+l Sg+li+p+++g+s +++v+hvd
  GSMUA_Achr7P01060_001 260 gGNIELIYMQTYAPTTLAAaRDFWTLRYTRGLEDGSLVICERSLTPATGGPTgppSPNFIRAEMLSSGYLIRPCEGGGSMIHIVDHVD 347
                            6***********************************************9999999********************************* PP

                            --SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
                  START 172 lkgrlphwllrslvksglaegaktwvatlqrqce 205
                            l++++++++lr+l++s  + ++k++ a+++++++
  GSMUA_Achr7P01060_001 348 LDAWSVPEVLRPLYESPKFLAQKMTIAAFHHLRQ 381
                            *****************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.0E-19883IPR009057Homeodomain-like
PROSITE profilePS5007115.6452084IPR001356Homeobox domain
SMARTSM003892.1E-152288IPR001356Homeobox domain
SuperFamilySSF466897.7E-172587IPR009057Homeodomain-like
CDDcd000861.51E-162585No hitNo description
PfamPF000462.4E-162683IPR001356Homeobox domain
CDDcd146862.22E-477116No hitNo description
PROSITE profilePS5084825.608163363IPR002913START domain
Gene3DG3DSA:3.30.530.207.8E-24171356IPR023393START-like domain
SMARTSM002343.5E-47172382IPR002913START domain
SuperFamilySSF559614.53E-39173384No hitNo description
PfamPF018521.1E-50173381IPR002913START domain
PfamPF086706.1E-49710858IPR013978MEKHLA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 859 aa     Download sequence    Send to blast
MAMVASGREA GKGQQEAAAA MDTGKYVRYT PEQVEALERV YSECPKPSSL RRQQLVRECP  60
ILSNIEPKQI KVWFQNRRCR EKQRKEAFRL QTVNRKLNAM NKLLMEENDR LQKQVSELVY  120
ENGYMRQQLH NASVATTDTS CESVVTSGQH QRQQNPTPQH PQRDANPAGL LAIAEETLAE  180
FLSKATGTAV DWVQMVGMKP GPDSIGIVAV SHNCSGVAAR ACGLVSLEPT KVAEIIKDRP  240
AWYRDCRCID VLTVIPTSNG GNIELIYMQT YAPTTLAAAR DFWTLRYTRG LEDGSLVICE  300
RSLTPATGGP TGPPSPNFIR AEMLSSGYLI RPCEGGGSMI HIVDHVDLDA WSVPEVLRPL  360
YESPKFLAQK MTIAAFHHLR QIAQETSGEV PYGGGRQPAV LRTFSQRLSR GFNDAVNGFA  420
DDGWLLLGSD GVEDVTIAIN SSSNKLIGSH VNSSALFSTM GGGVLCAKAS MLLQNVPPAI  480
LVRFLREHRS EWADCGVDAY SAASLRTSPY AVPGVRTSSG LSGSQVILPL AHTLELEEFL  540
EVIKLEGHVF NQDDVILSRD VYLLQLCSGV DEDAVGACAQ LVFAPIDESF ADDVPLLPSG  600
FRVIPLEPKT DSPVASRTLD LASTLEIGSG AASRSVNETA SSSYNLRSVL TIAFQFTYEN  660
HLQDNVAAMA RQYVRSVVAS VQRVAMAIAP RPSGQIGVEH LPQGFPEADT LARWISQSYR  720
AHTGLEILRE GSQTSDSLLK LLWHHSDAIV CCSLKARFRI YGSPVFTFSN QAGLDMLETT  780
LIALQDMTLE KTLDDGGRKL LCLEFPKIMQ QGFSYLPAGI CLSSMGRPVS YEQAVAWKVL  840
NDDDSPHCLA FMFLNWSFV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009408551.10.0PREDICTED: homeobox-leucine zipper protein HOX32-like
SwissprotQ6AST10.0HOX32_ORYSJ; Homeobox-leucine zipper protein HOX32
TrEMBLM0TDP60.0M0TDP6_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P01060_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37438197
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34710.10.0HD-ZIP family protein